PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010929361.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 745aa    MW: 85005.9 Da    PI: 9.6235
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010929361.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.71.5e-11481525953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     ++ ++ L ++F++n  ps++ +e L+k+lg++ ++V+ WF+N R+
  XP_010929361.1 481 SNAVQKLRQVFAENELPSRAVKENLSKQLGISSEKVSKWFKNARY 525
                     67899***************************************7 PP

2PHD33.41e-11215268151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+  fH+kCl+++le+ +  ++ wlC+ C++k
  XP_010929361.1 215 FCAKCRSreAFPDNDIILCDgTCNCGFHQKCLEPPLEKIPPGDQGWLCKFCECK 268
                     6999**955455********56***************8888888*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.25E-13207271IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.104.6E-12212269IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.549213268IPR019787Zinc finger, PHD-finger
SMARTSM002497.3E-7215266IPR001965Zinc finger, PHD-type
PfamPF006282.8E-9215268IPR019787Zinc finger, PHD-finger
CDDcd155046.41E-29215265No hitNo description
PROSITE patternPS013590216265IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.603.0E-12466524IPR009057Homeodomain-like
PROSITE profilePS5007112.487470530IPR001356Homeobox domain
SMARTSM003896.6E-10472534IPR001356Homeobox domain
CDDcd000863.01E-8473525No hitNo description
SuperFamilySSF466891.75E-10473533IPR009057Homeodomain-like
PfamPF000464.6E-9480525IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MQTSGNTSIC YKSRRSSRIR KELSSKINSL SRNKNSCNIS CNKSCNLKPR MRKKNIPNSK  60
PVETLQRISD SHAAKGRFSL QFLGNNNSCI CHKRNRKVAA GDHAIKLDKR KRRKRKQKNI  120
EQDEASRLQR RARYLLIKMK LEQNLLDAYS GDGWNGQSRE KIKPENELKR AKKQILECKL  180
GIRDAIHQLD LLSSIGSIED SVMYPDGSVF HEHIFCAKCR SREAFPDNDI ILCDGTCNCG  240
FHQKCLEPPL EKIPPGDQGW LCKFCECKME ILEAINAHLG TCFTANSSWE DIFKEAATGP  300
DVENIHLNHA EEWPSEDSED EDYNPEINEN NNSRTGIDEN MAGDSGSSSS LFCSSDEAMS  360
YSESRQTNGN GRSFHVQNKD RNKADFVDSI NTESGEEIMS YRRQRRDVDY KKLHDEMFGK  420
DLTENEQQSE DEDWGPRRRK RRTESTTGTI MANCVNEDGC SDTVSTKKIS LDRKPLFRIP  480
SNAVQKLRQV FAENELPSRA VKENLSKQLG ISSEKVSKWF KNARYAALKT RKAGITKPHH  540
VNSVTKRTRI NAGKSRSFDE VASVDDSILL PLSSIIHVRG NFRNILQRKT QRSMNIPSRM  600
QHKRAANTRS TNEFQTFRTS LTANQGPSIS VNGNLLELIL PHSQARTSVT NSMNLKKQVC  660
GRRSKFTLER AFRTRRGTVF QQHEMTENQQ LYLAEIERLC GLEERLQNLK KALLSCKDNE  720
SESVKTHLTE QSVIYVPVAE VKVRE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108113KRKRRK
2109115RKRRKRK
3109116RKRRKRKQ
4435439PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929360.10.0PREDICTED: pathogenesis-related homeodomain protein-like
RefseqXP_010929361.10.0PREDICTED: pathogenesis-related homeodomain protein-like
SwissprotP487851e-136PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLM0TT420.0M0TT42_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P23890_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-135pathogenesis related homeodomain protein A